Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries) |
Domain d2a28d1: 2a28 D:3-54 [162657] Other proteins in same PDB: d2a28a2, d2a28b2, d2a28c2, d2a28d2 automated match to d1zuua1 |
PDB Entry: 2a28 (more details), 1.07 Å
SCOPe Domain Sequences for d2a28d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a28d1 b.34.2.0 (D:3-54) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} meaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
Timeline for d2a28d1: