Lineage for d2a28d1 (2a28 D:3-54)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054186Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)
  8. 2054190Domain d2a28d1: 2a28 D:3-54 [162657]
    Other proteins in same PDB: d2a28a2, d2a28b2, d2a28c2, d2a28d2
    automated match to d1zuua1

Details for d2a28d1

PDB Entry: 2a28 (more details), 1.07 Å

PDB Description: Atomic-resolution crystal structure of the second SH3 domain of yeast Bzz1 determined from a pseudomerohedrally twinned crystal
PDB Compounds: (D:) BZZ1 protein

SCOPe Domain Sequences for d2a28d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a28d1 b.34.2.0 (D:3-54) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck

SCOPe Domain Coordinates for d2a28d1:

Click to download the PDB-style file with coordinates for d2a28d1.
(The format of our PDB-style files is described here.)

Timeline for d2a28d1: