SCOPe 2.03: Domain d2a28a_: 2a28 A:

Lineage for d2a28a_ (2a28 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (9 PDB entries)

8. Domain d2a28a_: 2a28 A: [162654]
   automated match to d1zuua1

Details for d2a28a_

PDB Entry: 2a28, 1.07 Å

PDB Description: Atomic-resolution crystal structure of the second SH3 domain of yeast Bzz1 determined from a pseudomerohedrally twinned crystal

PDB Compounds: (A:) BZZ1 protein

SCOPe Domain Sequences for d2a28a_:

Sequence; same for both SEQRES and ATOM records:

>d2a28a_ b.34.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck

Timeline for d2a28a_:

• d2a28a_ first appeared in SCOPe 2.01
  
• d2a28a_ appears in SCOPe 2.02
  
• d2a28a_ appears in SCOPe 2.04
  
• d2a28a_ appears in the current release, SCOPe 2.08, called d2a28a1