SCOPe 2.01: Domain d2a25a_: 2a25 A:

Lineage for d2a25a_ (2a25 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (2 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)

6. Protein automated matches [190456] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187371] (1 PDB entry)

8. Domain d2a25a_: 2a25 A: [162653]
   automated match to d1k2fa_
   complexed with zn

Details for d2a25a_

PDB Entry: 2a25, 2.2 Å

PDB Description: crystal structure of siah1 sbd bound to the peptide ekpaavvapittg from sip

PDB Compounds: (A:) Ubiquitin ligase SIAH1

SCOPe Domain Sequences for d2a25a_:

Sequence, based on SEQRES records:

>d2a25a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyscpcpgasckwqgsldavmphlmhqhksittlqgedivflatdinlpgavdwvmmqsc
fgfhfmlvlekqekydghqqffaivqligtrkqaenfayrlelnghrrrltweatprsih
egiataimnsdclvfdtsiaqlfaengnlginvtismc

Sequence, based on observed residues (ATOM records):

>d2a25a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyscpcpsckwqgsldavmphlmhqhksittlqgedivflatdinvdwvmmqscfgfhfm
lvlekqqqffaivqligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdc
lvfdtsiaqlfaengnlginvtismc

Timeline for d2a25a_:

• d2a25a_ is new in SCOPe 2.01-stable
  
• d2a25a_ appears in SCOPe 2.02
  
• d2a25a_ appears in the current release, SCOPe 2.08