Lineage for d2a19b1 (2a19 B:258-541)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1125 PDB entries)
  8. 2547082Domain d2a19b1: 2a19 B:258-541 [162646]
    Other proteins in same PDB: d2a19a1, d2a19a2, d2a19a3, d2a19b2, d2a19c2
    automated match to d2java1
    complexed with anp, mg, po4

Details for d2a19b1

PDB Entry: 2a19 (more details), 2.5 Å

PDB Description: PKR kinase domain- eIF2alpha- AMP-PNP complex.
PDB Compounds: (B:) Interferon-induced, double-stranded RNA-activated protein kinase

SCOPe Domain Sequences for d2a19b1:

Sequence, based on SEQRES records: (download)

>d2a19b1 d.144.1.0 (B:258-541) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakldh
vnivhyngcwdgfdydpetssknssrsktkclfiqmefcdkgtleqwiekrrgekldkvl
alelfeqitkgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskg
tlrymspeqissqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdifdkk
ektllqkllskkpedrpntseilrtltvwkk

Sequence, based on observed residues (ATOM records): (download)

>d2a19b1 d.144.1.0 (B:258-541) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakldh
vnivhyngcwdgfdydrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqit
kgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymspeq
issqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkll
skkpedrpntseilrtltvwkk

SCOPe Domain Coordinates for d2a19b1:

Click to download the PDB-style file with coordinates for d2a19b1.
(The format of our PDB-style files is described here.)

Timeline for d2a19b1: