SCOPe 2.03: Domain d2a08a_: 2a08 A:

Lineage for d2a08a_ (2a08 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (3 PDB entries)

8. Domain d2a08a_: 2a08 A: [162641]
   automated match to d1oota_

Details for d2a08a_

PDB Entry: 2a08, 1.54 Å

PDB Description: structure of the yeast yhh6 sh3 domain

PDB Compounds: (A:) Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic region

SCOPe Domain Sequences for d2a08a_:

Sequence; same for both SEQRES and ATOM records:

>d2a08a_ b.34.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
amatavalynfageqpgdlafkkgdvitilkksdsqndwwtgrtngkegifpanyvrvs

Timeline for d2a08a_:

• d2a08a_ first appeared in SCOPe 2.01
  
• d2a08a_ appears in SCOPe 2.02
  
• d2a08a_ appears in SCOPe 2.04
  
• d2a08a_ appears in the current release, SCOPe 2.08, called d2a08a1