Lineage for d2a08a_ (2a08 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120957Protein automated matches [190043] (5 species)
    not a true protein
  7. 1120958Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (3 PDB entries)
  8. 1120960Domain d2a08a_: 2a08 A: [162641]
    automated match to d1oota_

Details for d2a08a_

PDB Entry: 2a08 (more details), 1.54 Å

PDB Description: structure of the yeast yhh6 sh3 domain
PDB Compounds: (A:) Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic region

SCOPe Domain Sequences for d2a08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a08a_ b.34.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
amatavalynfageqpgdlafkkgdvitilkksdsqndwwtgrtngkegifpanyvrvs

SCOPe Domain Coordinates for d2a08a_:

Click to download the PDB-style file with coordinates for d2a08a_.
(The format of our PDB-style files is described here.)

Timeline for d2a08a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a08b_