SCOPe 2.08: Domain d1wjeb_: 1wje B:

Lineage for d1wjeb_ (1wje B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families)

5. Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins)
   Zn-binding site is near the C-terminus
   Pfam PF02022

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)

8. Domain d1wjeb_: 1wje B: [16264]
   complexed with cd; mutant

Details for d1wjeb_

PDB Entry: 1wje

PDB Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure

PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1wjeb_:

Sequence; same for both SEQRES and ATOM records:

>d1wjeb_ a.4.10.1 (B:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk

Timeline for d1wjeb_:

• d1wjeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1wjeb_ appears in SCOPe 2.07