| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin [52835] (16 species) |
| Species Escherichia coli [TaxId:562] [52836] (55 PDB entries) Uniprot P00274 ! Uniprot P00581 |
| Domain d1zzya_: 1zzy A: [162639] automated match to d1xoaa_ mutant |
PDB Entry: 1zzy (more details), 2.5 Å
SCOPe Domain Sequences for d1zzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzya_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
Timeline for d1zzya_: