SCOPe 2.05: Domain d1wjea_: 1wje A:

Lineage for d1wjea_ (1wje A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family)

5. Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
   Zn-binding site is near the C-terminus

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)

8. Domain d1wjea_: 1wje A: [16263]
   complexed with cd; mutant

Details for d1wjea_

PDB Entry: 1wje

PDB Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure

PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d1wjea_:

Sequence; same for both SEQRES and ATOM records:

>d1wjea_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk

Timeline for d1wjea_:

• d1wjea_ first appeared (with stable ids) in SCOP 1.55
  
• d1wjea_ appears in SCOPe 2.04
  
• d1wjea_ appears in SCOPe 2.06
  
• d1wjea_ appears in the current release, SCOPe 2.08