SCOPe 2.05: Domain d1zysa_: 1zys A:

Lineage for d1zysa_ (1zys A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
   CaMK group; CAMKL subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [64405] (61 PDB entries)

8. Domain d1zysa_: 1zys A: [162628]
   automated match to d1ia8a_
   complexed with 199, so4

Details for d1zysa_

PDB Entry: 1zys, 1.7 Å

PDB Description: co-crystal structure of checkpoint kinase chk1 with a pyrrolo-pyridine inhibitor

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d1zysa_:

Sequence; same for both SEQRES and ATOM records:

>d1zysa_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinaml
nhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylh
gigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrr
efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall
hkilvenpsaritipdikkdrwynkplkkga

Timeline for d1zysa_:

• d1zysa_ first appeared in SCOPe 2.01
  
• d1zysa_ appears in SCOPe 2.04
  
• d1zysa_ appears in SCOPe 2.06
  
• d1zysa_ appears in the current release, SCOPe 2.08