| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Cell cycle checkpoint kinase chk1 [64404] (1 species) CaMK group; CAMKL subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [64405] (100 PDB entries) |
| Domain d1zysa_: 1zys A: [162628] automated match to d1ia8a_ complexed with 199, so4 |
PDB Entry: 1zys (more details), 1.7 Å
SCOPe Domain Sequences for d1zysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zysa_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinaml
nhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylh
gigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrr
efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall
hkilvenpsaritipdikkdrwynkplkkga
Timeline for d1zysa_: