Lineage for d1zysa_ (1zys A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980339Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
    CaMK group; CAMKL subfamily; serine/threonine kinase
  7. 2980340Species Human (Homo sapiens) [TaxId:9606] [64405] (100 PDB entries)
  8. 2980376Domain d1zysa_: 1zys A: [162628]
    automated match to d1ia8a_
    complexed with 199, so4

Details for d1zysa_

PDB Entry: 1zys (more details), 1.7 Å

PDB Description: co-crystal structure of checkpoint kinase chk1 with a pyrrolo-pyridine inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d1zysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zysa_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinaml
nhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylh
gigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrr
efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall
hkilvenpsaritipdikkdrwynkplkkga

SCOPe Domain Coordinates for d1zysa_:

Click to download the PDB-style file with coordinates for d1zysa_.
(The format of our PDB-style files is described here.)

Timeline for d1zysa_: