SCOPe 2.05: Domain d1zxxa_: 1zxx A:

Lineage for d1zxxa_ (1zxx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.89: Phosphofructokinase [53783] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
   Domain 2 has parallel sheet of 4 strands, order 2314

4. Superfamily c.89.1: Phosphofructokinase [53784] (2 families)

5. Family c.89.1.0: automated matches [191515] (1 protein)
   not a true family

6. Protein automated matches [190865] (1 species)
   not a true protein

7. Species Lactobacillus delbrueckii [TaxId:1585] [188206] (1 PDB entry)

8. Domain d1zxxa_: 1zxx A: [162627]
   automated match to d3pfka_
   complexed with so4

Details for d1zxxa_

PDB Entry: 1zxx, 1.85 Å

PDB Description: The crystal structure of phosphofructokinase from Lactobacillus delbrueckii

PDB Compounds: (A:) 6-phosphofructokinase

SCOPe Domain Sequences for d1zxxa_:

Sequence; same for both SEQRES and ATOM records:

>d1zxxa_ c.89.1.0 (A:) automated matches {Lactobacillus delbrueckii [TaxId: 1585]}
mkrigiltsggdapgmnaavravtrvaianglevfgirygfaglvagdifplesedvahl
invsgtflysarypefaeeegqlagieqlkkhgidavvviggdgsyhgalqltrhgfnsi
glpgtidndipytdatigydtacmtamdaidkirdtasshhrvfivnvmgrncgdiamrv
gvacgadaiviperpydveeianrlkqaqesgkdhglvvvaegvmtadqfmaelkkygdf
dvranvlghmqrggtptvsdrvlasklgseavhlllegkgglavgiengkvtshdildlf
deshrgdydllklnadlsr

Timeline for d1zxxa_:

• d1zxxa_ first appeared in SCOPe 2.01
  
• d1zxxa_ appears in SCOPe 2.04
  
• d1zxxa_ appears in SCOPe 2.06
  
• d1zxxa_ appears in the current release, SCOPe 2.08