Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.89: Phosphofructokinase [53783] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest Domain 2 has parallel sheet of 4 strands, order 2314 |
Superfamily c.89.1: Phosphofructokinase [53784] (2 families) |
Family c.89.1.0: automated matches [191515] (1 protein) not a true family |
Protein automated matches [190865] (1 species) not a true protein |
Species Lactobacillus delbrueckii [TaxId:1585] [188206] (1 PDB entry) |
Domain d1zxxa_: 1zxx A: [162627] automated match to d3pfka_ complexed with so4 |
PDB Entry: 1zxx (more details), 1.85 Å
SCOPe Domain Sequences for d1zxxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxxa_ c.89.1.0 (A:) automated matches {Lactobacillus delbrueckii [TaxId: 1585]} mkrigiltsggdapgmnaavravtrvaianglevfgirygfaglvagdifplesedvahl invsgtflysarypefaeeegqlagieqlkkhgidavvviggdgsyhgalqltrhgfnsi glpgtidndipytdatigydtacmtamdaidkirdtasshhrvfivnvmgrncgdiamrv gvacgadaiviperpydveeianrlkqaqesgkdhglvvvaegvmtadqfmaelkkygdf dvranvlghmqrggtptvsdrvlasklgseavhlllegkgglavgiengkvtshdildlf deshrgdydllklnadlsr
Timeline for d1zxxa_: