SCOPe 2.01: Domain d1zwsd_: 1zws D:

Lineage for d1zwsd_ (1zws D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)

8. Domain d1zwsd_: 1zws D: [162617]
   automated match to d1ig1a_

Details for d1zwsd_

PDB Entry: 1zws, 2.9 Å

PDB Description: crystal structure of the catalytic domain of human drp-1 kinase

PDB Compounds: (D:) DAP-kinase related protein 1

SCOPe Domain Sequences for d1zwsd_:

Sequence; same for both SEQRES and ATOM records:

>d1zwsd_ d.144.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
shtselakdfirkllvketrkrltiqealrhpwitpvd

Timeline for d1zwsd_:

• d1zwsd_ is new in SCOPe 2.01-stable
  
• d1zwsd_ appears in SCOPe 2.02
  
• d1zwsd_ appears in the current release, SCOPe 2.08