Lineage for d1zwsc_ (1zws C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1435681Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries)
  8. 1436243Domain d1zwsc_: 1zws C: [162616]
    automated match to d1ig1a_

Details for d1zwsc_

PDB Entry: 1zws (more details), 2.9 Å

PDB Description: crystal structure of the catalytic domain of human drp-1 kinase
PDB Compounds: (C:) DAP-kinase related protein 1

SCOPe Domain Sequences for d1zwsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwsc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
shtselakdfirkllvketrkrltiqealrhpwitpvd

SCOPe Domain Coordinates for d1zwsc_:

Click to download the PDB-style file with coordinates for d1zwsc_.
(The format of our PDB-style files is described here.)

Timeline for d1zwsc_: