Lineage for d1zvkb_ (1zvk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873793Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
    elaborated with additional structures
  6. 2873822Protein automated matches [190864] (1 species)
    not a true protein
  7. 2873823Species Alicyclobacillus sendaiensis [TaxId:192387] [188204] (3 PDB entries)
  8. 2873825Domain d1zvkb_: 1zvk B: [162608]
    automated match to d1sioa_
    complexed with ca; mutant

Details for d1zvkb_

PDB Entry: 1zvk (more details), 2.04 Å

PDB Description: structure of double mutant, d164n, e78h of kumamolisin-as
PDB Compounds: (B:) kumamolisin-As

SCOPe Domain Sequences for d1zvkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvkb_ c.41.1.2 (B:) automated matches {Alicyclobacillus sendaiensis [TaxId: 192387]}
taytpldvaqayqfpegldgqgqciaiielgggydeaslaqyfaslgvpapqvvsvsvdg
asnqptgdpsgpdghveldievagalapgakfavyfapntdagfldaittaihdptlkps
vvsiswggpedswtsaaiaamnrafldaaalgvtvlaaagnsgstdgeqdglyhvdfpaa
spyvlacggtrlvasggriaqetvwndgpdggatgggvsrifplpawqehanvppsanpg
assgrgvpdlagnadpatgyevvidgeatviggtsavaplfaalvarinqklgkavgyln
ptlyqlpadvfhditegnndianraqiyqagpgwdpctglgspigvrllqallps

SCOPe Domain Coordinates for d1zvkb_:

Click to download the PDB-style file with coordinates for d1zvkb_.
(The format of our PDB-style files is described here.)

Timeline for d1zvkb_: