Lineage for d1wjaa_ (1wja A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695622Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) (S)
  5. 2695623Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins)
    Zn-binding site is near the C-terminus
    Pfam PF02022
  6. 2695624Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 2695625Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)
  8. 2695644Domain d1wjaa_: 1wja A: [16259]
    complexed with zn

Details for d1wjaa_

PDB Entry: 1wja (more details)

PDB Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, regularized mean structure
PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d1wjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjaa_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg

SCOPe Domain Coordinates for d1wjaa_:

Click to download the PDB-style file with coordinates for d1wjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wjaa_: