Lineage for d1ztla_ (1ztl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404847Protein Coagulation factor XI [117237] (1 species)
  7. 2404848Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
    Uniprot P03951 388-624
  8. 2404888Domain d1ztla_: 1ztl A: [162584]
    automated match to d1xxda_
    complexed with 737, so4

Details for d1ztla_

PDB Entry: 1ztl (more details), 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with n-[4-guanidino-1-(thiazole-2-carbonyl)-butyl]-2-{6-oxo- 5-[(quinolin-8-ylmethyl)-amino]-2-m-tolyl-6h-pyrimidin-1-yl}- acetamide
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1ztla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztla_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1ztla_:

Click to download the PDB-style file with coordinates for d1ztla_.
(The format of our PDB-style files is described here.)

Timeline for d1ztla_: