Lineage for d1zrka_ (1zrk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793669Protein Coagulation factor XI [117237] (1 species)
  7. 1793670Species Human (Homo sapiens) [TaxId:9606] [117238] (32 PDB entries)
    Uniprot P03951 388-624
  8. 1793684Domain d1zrka_: 1zrk A: [162575]
    automated match to d1xx9b_
    complexed with 367, so4

Details for d1zrka_

PDB Entry: 1zrk (more details), 2.3 Å

PDB Description: factor xi complexed with 3-hydroxypropyl 3-(7-amidinonaphthalene-1- carboxamido)benzenesulfonate
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1zrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrka_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseiaedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1zrka_:

Click to download the PDB-style file with coordinates for d1zrka_.
(The format of our PDB-style files is described here.)

Timeline for d1zrka_: