Lineage for d1zpca_ (1zpc A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128053Protein Coagulation factor XI [117237] (1 species)
  7. 1128054Species Human (Homo sapiens) [TaxId:9606] [117238] (26 PDB entries)
    Uniprot P03951 388-624
  8. 1128077Domain d1zpca_: 1zpc A: [162572]
    automated match to d1xxda_
    complexed with 716, so4

Details for d1zpca_

PDB Entry: 1zpc (more details), 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with 2-[2-(3-chloro-phenyl)-2-hydroxy-acetylamino]-n-[4- guanidino-1-(thiazole-2-carbonyl)-butyl]-3-methyl-butyramide
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1zpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpca_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1zpca_:

Click to download the PDB-style file with coordinates for d1zpca_.
(The format of our PDB-style files is described here.)

Timeline for d1zpca_: