Lineage for d1zose_ (1zos E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2497019Species Streptococcus pneumoniae [TaxId:171101] [188196] (1 PDB entry)
  8. 2497024Domain d1zose_: 1zos E: [162568]
    automated match to d1jysa_
    complexed with mtm

Details for d1zose_

PDB Entry: 1zos (more details), 1.6 Å

PDB Description: structure of 5'-methylthionadenosine/s-adenosylhomocysteine nucleosidase from s. pneumoniae with a transition-state inhibitor mt- imma
PDB Compounds: (E:) 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d1zose_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zose_ c.56.2.0 (E:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mkigiiaampeelaylvqhldntqeqvvlgntyhtgtiashevvlvesgigkvmsamsva
iladhfqvdalintgsagavaegiavgdvviadklayhdvdvtafgyaygqmaqqplyfe
sdktfvaqiqeslsqldqnwhlgliatgdsfvagndkieaikshfpevlavemegaaiaq
aahtlnlpvlviramsdnanheaniffdefiieagrrsaqvllaflkald

SCOPe Domain Coordinates for d1zose_:

Click to download the PDB-style file with coordinates for d1zose_.
(The format of our PDB-style files is described here.)

Timeline for d1zose_: