SCOPe 2.04: Domain d1zora_: 1zor A:

Lineage for d1zora_ (1zor A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (13 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188199] (1 PDB entry)

8. Domain d1zora_: 1zor A: [162562]
   automated match to d1lwda_
   complexed with na

Details for d1zora_

PDB Entry: 1zor, 2.24 Å

PDB Description: isocitrate dehydrogenase from the hyperthermophile thermotoga maritima

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1zora_:

Sequence; same for both SEQRES and ATOM records:

>d1zora_ c.77.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mekvkvknpiveldgdemarvmwkmikeklilpyldiqlvyfdlgikkrdetddqitiea
akaikkygvgvkcatitpdaervkeynlkkawkspnatirayldgtvfrkpimvknvppl
vkrwkkpiiigrhaygdiynaveakvegpaevelvvrnkenktllvhkfegngvvmamhn
leksirsfaqscinyaisekvdiwfatkdtiskvyhayfkdifqeevdkrkeelekagvn
yrymliddaaaqilrseggmlwacmnyegdimsdmiasgfgslglmtsvlvspdgvyefe
aahgtvrrhyyrylkgektstnptasifawtgairkrgeldgtpevcefadklekavint
iesgvitkdlqpfteppidkyvtleefidevkknlekll

Timeline for d1zora_:

• d1zora_ first appeared in SCOPe 2.01
  
• d1zora_ appears in SCOPe 2.03
  
• d1zora_ appears in SCOPe 2.05
  
• d1zora_ appears in the current release, SCOPe 2.08