Lineage for d1zoia_ (1zoi A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151524Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2151561Protein automated matches [190860] (3 species)
    not a true protein
  7. 2151597Species Pseudomonas putida [TaxId:303] [188197] (1 PDB entry)
  8. 2151598Domain d1zoia_: 1zoi A: [162558]
    automated match to d1a88a_

Details for d1zoia_

PDB Entry: 1zoi (more details), 1.6 Å

PDB Description: Crystal Structure of a Stereoselective Esterase from Pseudomonas putida IFO12996
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d1zoia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoia_ c.69.1.12 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
syvttkdgvqifykdwgprdapvihfhhgwplsaddwdaqllfflahgyrvvahdrrghg
rssqvwdghdmdhyaddvaavvahlgiqgavhvghstgggevvrymarhpedkvakavli
aavpplmvqtpgnpgglpksvfdgfqaqvasnraqfyrdvpagpfygynrpgveasegii
gnwwrqgmigsakahydgivafsqtdftedlkgiqqpvlvmhgdddqivpyensgvlsak
llpngalktykgyphgmptthadvinadllafirs

SCOPe Domain Coordinates for d1zoia_:

Click to download the PDB-style file with coordinates for d1zoia_.
(The format of our PDB-style files is described here.)

Timeline for d1zoia_: