| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.12: Haloperoxidase [53531] (8 proteins) |
| Protein automated matches [190860] (2 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [188197] (1 PDB entry) |
| Domain d1zoia_: 1zoi A: [162558] automated match to d1a88a_ |
PDB Entry: 1zoi (more details), 1.6 Å
SCOPe Domain Sequences for d1zoia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoia_ c.69.1.12 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
syvttkdgvqifykdwgprdapvihfhhgwplsaddwdaqllfflahgyrvvahdrrghg
rssqvwdghdmdhyaddvaavvahlgiqgavhvghstgggevvrymarhpedkvakavli
aavpplmvqtpgnpgglpksvfdgfqaqvasnraqfyrdvpagpfygynrpgveasegii
gnwwrqgmigsakahydgivafsqtdftedlkgiqqpvlvmhgdddqivpyensgvlsak
llpngalktykgyphgmptthadvinadllafirs
Timeline for d1zoia_: