SCOPe 2.05: Domain d1hnwr_: 1hnw R:

Lineage for d1hnwr_ (1hnw R:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1hnwr_: 1hnw R: [16255]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwr_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1hnwr_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1hnwr_:

• d1hnwr_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwr_ appears in SCOPe 2.04
  
• d1hnwr_ appears in SCOPe 2.06
  
• d1hnwr_ appears in the current release, SCOPe 2.08