Lineage for d1hnwr_ (1hnw R:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 439259Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 439260Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 439261Protein Ribosomal protein S18 [46913] (1 species)
  7. 439262Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 439269Domain d1hnwr_: 1hnw R: [16255]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwr_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1hnwr_:

Click to download the PDB-style file with coordinates for d1hnwr_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwr_: