Lineage for d1zmoe_ (1zmo E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580199Species Arthrobacter sp. [TaxId:168809] [188194] (1 PDB entry)
  8. 1580204Domain d1zmoe_: 1zmo E: [162546]
    automated match to d1pwxa_

Details for d1zmoe_

PDB Entry: 1zmo (more details), 2 Å

PDB Description: Apo structure of haloalcohol dehalogenase HheA of Arthrobacter sp. AD2
PDB Compounds: (E:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zmoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmoe_ c.2.1.0 (E:) automated matches {Arthrobacter sp. [TaxId: 168809]}
vialvtharhfagpaavealtqdgytvvchdasfadaaerqrfesenpgtialaeqkper
lvdatlqhgeaidtivsndyiprpmnrlplegtseadirqmfealsifpilllqsaiapl
raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
nptyfptsdwennpelrervdrdvplgrlgrpdemgalitflasrraapivgqffaftgg
ylp

SCOPe Domain Coordinates for d1zmoe_:

Click to download the PDB-style file with coordinates for d1zmoe_.
(The format of our PDB-style files is described here.)

Timeline for d1zmoe_: