SCOPe 2.01: Domain d1zmna_: 1zmn A:

Lineage for d1zmna_ (1zmn A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Coagulation factor XI [117237] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117238] (24 PDB entries)
   Uniprot P03951 388-624

8. Domain d1zmna_: 1zmn A: [162541]
   automated match to d1xxda_
   complexed with 427, so4

Details for d1zmna_

PDB Entry: 1zmn, 2.05 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with (r)-1-(4-(4-(hydroxymethyl)-1,3,2-dioxaborolan-2-yl) phenyl)guanidine

PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1zmna_:

Sequence; same for both SEQRES and ATOM records:

>d1zmna_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

Timeline for d1zmna_:

• d1zmna_ is new in SCOPe 2.01-stable
  
• d1zmna_ appears in SCOPe 2.02
  
• d1zmna_ appears in the current release, SCOPe 2.08