Lineage for d1hnzr_ (1hnz R:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45858Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 45859Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 45860Protein Ribosomal protein S18 [46913] (1 species)
  7. 45861Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries)
  8. 45865Domain d1hnzr_: 1hnz R: [16254]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzr_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1hnzr_:

Click to download the PDB-style file with coordinates for d1hnzr_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzr_: