Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins) the core motif is inserted in a six-stranded meander beta-sheet domain |
Protein Nuclease NucA [159863] (1 species) |
Species Nostoc sp. PCC 7120 [TaxId:103690] [159864] (2 PDB entries) Uniprot P38446 35-274 |
Domain d1zm8a_: 1zm8 A: [162528] automated match to d2o3ba1 complexed with mn, na, so4 |
PDB Entry: 1zm8 (more details), 1.9 Å
SCOPe Domain Sequences for d1zm8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm8a_ d.4.1.2 (A:) Nuclease NucA {Nostoc sp. PCC 7120 [TaxId: 103690]} isvhlllgnpsgatptkltpdnylmvknqyalsynnskgtanwvawqlnsswlgnaerqd nfrpdktlpagwvrvtpsmysgsgyarghiapsadrtkttednaatflmtnmmpqtpdnn rntwgnledycrelvsqgkelyivagpngslgkplkgkvtvpkstwkivvvldspgsgle gitantrviavnipndpelnndwraykvsvdelesltgydflsnvspniqtsieskvdn
Timeline for d1zm8a_: