Lineage for d1zljh_ (1zlj H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695359Species Mycobacterium tuberculosis [TaxId:1773] [188191] (3 PDB entries)
  8. 2695369Domain d1zljh_: 1zlj H: [162526]
    Other proteins in same PDB: d1zljb2, d1zljf2
    automated match to d1fsea_

Details for d1zljh_

PDB Entry: 1zlj (more details), 2 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain
PDB Compounds: (H:) Dormancy Survival Regulator

SCOPe Domain Sequences for d1zljh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zljh_ a.4.6.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
qdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavf
atelkr

SCOPe Domain Coordinates for d1zljh_:

Click to download the PDB-style file with coordinates for d1zljh_.
(The format of our PDB-style files is described here.)

Timeline for d1zljh_: