Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (25 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [188191] (3 PDB entries) |
Domain d1zljf1: 1zlj F:144-209 [162524] Other proteins in same PDB: d1zljb2, d1zljf2 automated match to d1fsea_ |
PDB Entry: 1zlj (more details), 2 Å
SCOPe Domain Sequences for d1zljf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zljf1 a.4.6.0 (F:144-209) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} qdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavf atelkr
Timeline for d1zljf1: