SCOPe 2.01: Domain d1zlje_: 1zlj E:

Lineage for d1zlje_ (1zlj E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188191] (1 PDB entry)

8. Domain d1zlje_: 1zlj E: [162523]
   automated match to d1fsea_

Details for d1zlje_

PDB Entry: 1zlj, 2 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain

PDB Compounds: (E:) Dormancy Survival Regulator

SCOPe Domain Sequences for d1zlje_:

Sequence; same for both SEQRES and ATOM records:

>d1zlje_ a.4.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
telkrsrpp

Timeline for d1zlje_:

• d1zlje_ is new in SCOPe 2.01-stable
  
• d1zlje_ appears in SCOPe 2.02
  
• d1zlje_ appears in the current release, SCOPe 2.08