Lineage for d1zljc_ (1zlj C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984777Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984778Protein automated matches [190858] (17 species)
    not a true protein
  7. 1984810Species Mycobacterium tuberculosis [TaxId:1773] [188191] (3 PDB entries)
  8. 1984815Domain d1zljc_: 1zlj C: [162521]
    Other proteins in same PDB: d1zljb2, d1zljf2
    automated match to d1fsea_

Details for d1zljc_

PDB Entry: 1zlj (more details), 2 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain
PDB Compounds: (C:) Dormancy Survival Regulator

SCOPe Domain Sequences for d1zljc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zljc_ a.4.6.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
telkrsrpp

SCOPe Domain Coordinates for d1zljc_:

Click to download the PDB-style file with coordinates for d1zljc_.
(The format of our PDB-style files is described here.)

Timeline for d1zljc_: