![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries) |
![]() | Domain d1fjgr_: 1fjg R: [16252] Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgs_, d1fjgt_, d1fjgv_ complexed with mg, par, scm, sry, zn |
PDB Entry: 1fjg (more details), 3 Å
SCOP Domain Sequences for d1fjgr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjgr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1fjgr_: