Lineage for d1zkza_ (1zkz A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063985Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1063986Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1064210Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 1064211Protein automated matches [190506] (2 species)
    not a true protein
  7. 1064212Species Human (Homo sapiens) [TaxId:9606] [187459] (12 PDB entries)
  8. 1064221Domain d1zkza_: 1zkz A: [162508]
    automated match to d1m4ul_

Details for d1zkza_

PDB Entry: 1zkz (more details), 2.33 Å

PDB Description: crystal structure of bmp9
PDB Compounds: (A:) Growth/differentiation factor 2

SCOPe Domain Sequences for d1zkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkza_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr

SCOPe Domain Coordinates for d1zkza_:

Click to download the PDB-style file with coordinates for d1zkza_.
(The format of our PDB-style files is described here.)

Timeline for d1zkza_: