Lineage for d1g1xh_ (1g1x H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308916Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2308917Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2308918Protein Ribosomal protein S18 [46913] (2 species)
  7. 2308944Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 2308992Domain d1g1xh_: 1g1x H: [16250]
    Other proteins in same PDB: d1g1xa_, d1g1xb_, d1g1xf_, d1g1xg_
    partly disordered

Details for d1g1xh_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna
PDB Compounds: (H:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1g1xh_:

Sequence, based on SEQRES records: (download)

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft

Sequence, based on observed residues (ATOM records): (download)

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
dlrdyrnvevlkrflskilprtglsgkeqrilaktikrarilgllpft

SCOPe Domain Coordinates for d1g1xh_:

Click to download the PDB-style file with coordinates for d1g1xh_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xh_: