SCOPe 2.07: Domain d1zkmd1: 1zkm D:1-244

Lineage for d1zkmd1 (1zkm D:1-244)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.0: automated matches [191511] (1 protein)
   not a true family

6. Protein automated matches [190855] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188186] (2 PDB entries)

8. Domain d1zkmd1: 1zkm D:1-244 [162499]
   Other proteins in same PDB: d1zkmd2
   automated match to d1jw9b_
   complexed with zn

Details for d1zkmd1

PDB Entry: 1zkm, 2.95 Å

PDB Description: Structural Analysis of Escherichia Coli ThiF

PDB Compounds: (D:) Adenylyltransferase thiF

SCOPe Domain Sequences for d1zkmd1:

Sequence, based on SEQRES records:

>d1zkmd1 c.111.1.0 (D:1-244) automated matches {Escherichia coli [TaxId: 562]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
pvcg

Sequence, based on observed residues (ATOM records):

>d1zkmd1 c.111.1.0 (D:1-244) automated matches {Escherichia coli [TaxId: 562]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnagv
vgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcg

Timeline for d1zkmd1:

• d1zkmd1 first appeared in SCOPe 2.01, called d1zkmd_
  
• d1zkmd1 appears in SCOPe 2.06
  
• d1zkmd1 appears in the current release, SCOPe 2.08