Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.0: automated matches [191511] (1 protein) not a true family |
Protein automated matches [190855] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [188186] (2 PDB entries) |
Domain d1zkmd1: 1zkm D:1-244 [162499] Other proteins in same PDB: d1zkmd2 automated match to d1jw9b_ complexed with zn |
PDB Entry: 1zkm (more details), 2.95 Å
SCOPe Domain Sequences for d1zkmd1:
Sequence, based on SEQRES records: (download)
>d1zkmd1 c.111.1.0 (D:1-244) automated matches {Escherichia coli [TaxId: 562]} mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc pvcg
>d1zkmd1 c.111.1.0 (D:1-244) automated matches {Escherichia coli [TaxId: 562]} mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnagv vgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcg
Timeline for d1zkmd1: