Lineage for d1zk5a_ (1zk5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767770Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2767785Protein automated matches [190525] (1 species)
    not a true protein
  7. 2767786Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)
  8. 2767787Domain d1zk5a_: 1zk5 A: [162494]
    automated match to d1oioa_
    complexed with nag

Details for d1zk5a_

PDB Entry: 1zk5 (more details), 1.4 Å

PDB Description: escherichia coli f17fg lectin domain complex with n-acetylglucosamine
PDB Compounds: (A:) f17g adhesin subunit

SCOPe Domain Sequences for d1zk5a_:

Sequence, based on SEQRES records: (download)

>d1zk5a_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsyssthamdnlpfvyntghnigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

Sequence, based on observed residues (ATOM records): (download)

>d1zk5a_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsyssthnlpfvyntghnigyqnanvwrisggfcvgldgkvdlp
vvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqglsvh
vrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

SCOPe Domain Coordinates for d1zk5a_:

Click to download the PDB-style file with coordinates for d1zk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1zk5a_: