Lineage for d1zjjb_ (1zjj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920628Species Pyrococcus horikoshii OT3 [TaxId:70601] [187354] (3 PDB entries)
  8. 2920631Domain d1zjjb_: 1zjj B: [162493]
    automated match to d1vjra_
    complexed with mg

Details for d1zjjb_

PDB Entry: 1zjj (more details), 1.85 Å

PDB Description: Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) hypothetical protein PH1952

SCOPe Domain Sequences for d1zjjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjjb_ c.108.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgid
vsssiiitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevk
hvvvgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnv
epiiigkpnepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledik
kseykpdlvlpsvyelidylktl

SCOPe Domain Coordinates for d1zjjb_:

Click to download the PDB-style file with coordinates for d1zjjb_.
(The format of our PDB-style files is described here.)

Timeline for d1zjjb_: