SCOPe 2.07: Domain d1zjjb_: 1zjj B:

Lineage for d1zjjb_ (1zjj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (52 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [187354] (3 PDB entries)

8. Domain d1zjjb_: 1zjj B: [162493]
   automated match to d1vjra_
   complexed with mg

Details for d1zjjb_

PDB Entry: 1zjj, 1.85 Å

PDB Description: Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) hypothetical protein PH1952

SCOPe Domain Sequences for d1zjjb_:

Sequence; same for both SEQRES and ATOM records:

>d1zjjb_ c.108.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgid
vsssiiitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevk
hvvvgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnv
epiiigkpnepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledik
kseykpdlvlpsvyelidylktl

Timeline for d1zjjb_:

• d1zjjb_ first appeared in SCOPe 2.01
  
• d1zjjb_ appears in SCOPe 2.06