Lineage for d1g1xc_ (1g1x C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45858Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 45859Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 45860Protein Ribosomal protein S18 [46913] (1 species)
  7. 45861Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries)
  8. 45872Domain d1g1xc_: 1g1x C: [16249]
    Other proteins in same PDB: d1g1xa_, d1g1xb_, d1g1xf_, d1g1xg_

Details for d1g1xc_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xc_:

Sequence, based on SEQRES records: (download)

>d1g1xc_ a.4.8.1 (C:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft

Sequence, based on observed residues (ATOM records): (download)

>d1g1xc_ a.4.8.1 (C:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflilprtglsgkeqrilaktikrarilgllpft

SCOP Domain Coordinates for d1g1xc_:

Click to download the PDB-style file with coordinates for d1g1xc_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xc_: