Lineage for d1zj5a_ (1zj5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900378Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins)
    automatically mapped to Pfam PF01738
  6. 2900384Protein automated matches [190856] (2 species)
    not a true protein
  7. 2900385Species Pseudomonas putida [TaxId:303] [188188] (9 PDB entries)
  8. 2900389Domain d1zj5a_: 1zj5 A: [162489]
    automated match to d1dina_
    complexed with gol, so4; mutant

Details for d1zj5a_

PDB Entry: 1zj5 (more details), 1.7 Å

PDB Description: crystal structure analysis of the dienelactone hydrolase mutant (e36d, c123s, a134s, s208g, a229v, k234r) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.7 a
PDB Compounds: (A:) Carboxymethylenebutenolidase

SCOPe Domain Sequences for d1zj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zj5a_ c.69.1.9 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
mltegisiqsydghtfgalvgspakapapviviaqdifgvnafmretvswlvdqgyaavc
pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv
gyslggalaflvaskgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq
litegfganpllqvhwyeeaghsfartgssgyvasaaalanertldflvplqs

SCOPe Domain Coordinates for d1zj5a_:

Click to download the PDB-style file with coordinates for d1zj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1zj5a_: