Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins) |
Protein automated matches [190856] (1 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [188188] (8 PDB entries) |
Domain d1zi9a_: 1zi9 A: [162484] automated match to d1dina_ complexed with gol, so4; mutant |
PDB Entry: 1zi9 (more details), 1.5 Å
SCOPe Domain Sequences for d1zi9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zi9a_ c.69.1.9 (A:) automated matches {Pseudomonas putida [TaxId: 303]} mltegisiqsydghtfgalvgspakapapviviaqdifgvnafmretvswlvdqgyaavc pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv gyslggalaflvaakgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq litegfganpllqvhwyeeaghsfartsssgyvasaaalanertldflaplqs
Timeline for d1zi9a_: