Lineage for d1zi8a_ (1zi8 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003088Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins)
  6. 1003094Protein automated matches [190856] (1 species)
    not a true protein
  7. 1003095Species Pseudomonas putida [TaxId:303] [188188] (8 PDB entries)
  8. 1003096Domain d1zi8a_: 1zi8 A: [162483]
    automated match to d1dina_
    complexed with gol, so4; mutant

Details for d1zi8a_

PDB Entry: 1zi8 (more details), 1.4 Å

PDB Description: crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
PDB Compounds: (A:) Carboxymethylenebutenolidase

SCOPe Domain Sequences for d1zi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zi8a_ c.69.1.9 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
mltegisiqsydghtfgalvgspakapapviviaqdifgvnafmretvswlvdqgyaavc
pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv
gyslggalaflvaskgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq
litegfganpllqvhwyeeaghsfartgssgyvasaaalanertldflvplqs

SCOPe Domain Coordinates for d1zi8a_:

Click to download the PDB-style file with coordinates for d1zi8a_.
(The format of our PDB-style files is described here.)

Timeline for d1zi8a_: