Lineage for d1mmsb_ (1mms B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480444Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1480445Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1480446Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1480534Species Thermotoga maritima [TaxId:2336] [46910] (1 PDB entry)
  8. 1480536Domain d1mmsb_: 1mms B: [16248]
    Other proteins in same PDB: d1mmsa2
    protein/RNA complex; complexed with cd, mg, mmc

Details for d1mmsb_

PDB Entry: 1mms (more details), 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex
PDB Compounds: (B:) protein (ribosomal protein l11)

SCOPe Domain Sequences for d1mmsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmsb_ a.4.7.1 (B:) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOPe Domain Coordinates for d1mmsb_:

Click to download the PDB-style file with coordinates for d1mmsb_.
(The format of our PDB-style files is described here.)

Timeline for d1mmsb_: