SCOP 1.55: Domain d1mmsb1: 1mms B:

Lineage for d1mmsb1 (1mms B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [46910] (1 PDB entry)

8. Domain d1mmsb1: 1mms B: [16248]
   Other proteins in same PDB: d1mmsa2

Details for d1mmsb1

PDB Entry: 1mms, 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

SCOP Domain Sequences for d1mmsb1:

Sequence; same for both SEQRES and ATOM records:

>d1mmsb1 a.4.7.1 (B:) Ribosomal protein L11, C-terminal domain {Thermotoga maritima}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d1mmsb1:

• d1mmsb1 appears in SCOP 1.57
  
• d1mmsb1 appears in the current release, SCOPe 2.08, called d1mmsb_