Lineage for d1mmsb1 (1mms B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1710Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1711Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1712Protein Ribosomal protein L11, C-terminal domain [46908] (2 species)
  7. 1721Species Thermotoga maritima [TaxId:243274] [46910] (1 PDB entry)
  8. 1723Domain d1mmsb1: 1mms B: [16248]
    Other proteins in same PDB: d1mmsa2

Details for d1mmsb1

PDB Entry: 1mms (more details), 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1mmsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmsb1 a.4.7.1 (B:) Ribosomal protein L11, C-terminal domain {Thermotoga maritima}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOP Domain Coordinates for d1mmsb1:

Click to download the PDB-style file with coordinates for d1mmsb1.
(The format of our PDB-style files is described here.)

Timeline for d1mmsb1: