SCOPe 2.08: Domain d1mmsb_: 1mms B:

Lineage for d1mmsb_ (1mms B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Thermotoga maritima [TaxId:2336] [46910] (1 PDB entry)

8. Domain d1mmsb_: 1mms B: [16248]
   Other proteins in same PDB: d1mmsa2
   protein/RNA complex; complexed with cd, mg, mmc

Details for d1mmsb_

PDB Entry: 1mms, 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

PDB Compounds: (B:) protein (ribosomal protein l11)

SCOPe Domain Sequences for d1mmsb_:

Sequence; same for both SEQRES and ATOM records:

>d1mmsb_ a.4.7.1 (B:) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d1mmsb_:

• d1mmsb_ first appeared (with stable ids) in SCOP 1.55, called d1mmsb1
  
• d1mmsb_ appears in SCOPe 2.07