| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Thermotoga maritima [TaxId:2336] [46910] (1 PDB entry) |
| Domain d1mmsb_: 1mms B: [16248] Other proteins in same PDB: d1mmsa2 protein/RNA complex; complexed with cd, mg, mmc |
PDB Entry: 1mms (more details), 2.57 Å
SCOPe Domain Sequences for d1mmsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmsb_ a.4.7.1 (B:) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv
Timeline for d1mmsb_: