SCOPe 2.06: Domain d1zh9a_: 1zh9 A:

Lineage for d1zh9a_ (1zh9 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
   Uniprot P00918

8. Domain d1zh9a_: 1zh9 A: [162476]
   automated match to d1cana_
   complexed with be7, mpx, zn

Details for d1zh9a_

PDB Entry: 1zh9, 1.7 Å

PDB Description: carbonic anhydrase ii in complex with n-4-methyl-1-piperazinyl-n'-(p- sulfonamide)phenylthiourea as sulfonamide inhibitor

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1zh9a_:

Sequence; same for both SEQRES and ATOM records:

>d1zh9a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdakvlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf

Timeline for d1zh9a_:

• d1zh9a_ first appeared in SCOPe 2.01
  
• d1zh9a_ appears in SCOPe 2.05
  
• d1zh9a_ appears in SCOPe 2.07
  
• d1zh9a_ appears in the current release, SCOPe 2.08