Lineage for d1zh7a_ (1zh7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728836Protein Orphan nuclear receptor NR5a2 (LRH-1) [89147] (1 species)
  7. 2728837Species Mouse (Mus musculus) [TaxId:10090] [89148] (2 PDB entries)
  8. 2728840Domain d1zh7a_: 1zh7 A: [162474]
    automated match to d1pk5a_

Details for d1zh7a_

PDB Entry: 1zh7 (more details), 2.5 Å

PDB Description: structural and biochemical basis for selective repression of the orphan nuclear receptor lrh-1 by shp
PDB Compounds: (A:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d1zh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh7a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]}
asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
aalldytvcnypqqtekfgqlllrlpeiraiskqaedylyykhvngdvpynnlliemlha
kra

SCOPe Domain Coordinates for d1zh7a_:

Click to download the PDB-style file with coordinates for d1zh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1zh7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zh7b_