SCOP 1.73: Domain d1mmsa1: 1mms A:71-140

Lineage for d1mmsa1 (1mms A:71-140)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [46910] (5 PDB entries)

8. Domain d1mmsa1: 1mms A:71-140 [16247]
   Other proteins in same PDB: d1mmsa2
   protein/RNA complex; complexed with cd, mg, mmc; mutant

Details for d1mmsa1

PDB Entry: 1mms, 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

PDB Compounds: (A:) protein (ribosomal protein l11)

SCOP Domain Sequences for d1mmsa1:

Sequence; same for both SEQRES and ATOM records:

>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d1mmsa1:

• d1mmsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1mmsa1 appears in SCOP 1.71
  
• d1mmsa1 appears in SCOP 1.75
  
• d1mmsa1 appears in the current release, SCOPe 2.08